SCOP 1.67: Domain d1umwa1: 1umw A:373-500

Lineage for d1umwa1 (1umw A:373-500)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (3 PDB entries)

8. Domain d1umwa1: 1umw A:373-500 [99631]

Details for d1umwa1

PDB Entry: 1umw, 1.9 Å

PDB Description: structure of a human plk1 polo-box domain/phosphopeptide complex

SCOP Domain Sequences for d1umwa1:

Sequence; same for both SEQRES and ATOM records:

>d1umwa1 d.223.1.2 (A:373-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens)}
hlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdnsv
gvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehllk
aganitpr

Timeline for d1umwa1:

• d1umwa1 is new in SCOP 1.67
  
• d1umwa1 appears in SCOP 1.69
  
• d1umwa1 appears in the current release, SCOPe 2.08