| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (22 proteins) |
| Protein Snake coagglutinin beta chain [88867] (9 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
| Species South american rattlesnake (Crotalus durissus terrificus), convulxin [TaxId:8732] [103348] (1 PDB entry) |
| Domain d1umrc_: 1umr C: [99628] Other proteins in same PDB: d1umra_, d1umrb_ |
PDB Entry: 1umr (more details), 2.4 Å
SCOP Domain Sequences for d1umrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umrc_ d.169.1.1 (C:) Snake coagglutinin beta chain {South american rattlesnake (Crotalus durissus terrificus), convulxin}
gfccpshwssydrycykvfkqemtwadaekfctqqhtgshlvsfhsteevdfvvkmthqs
lkstffwiganniwnkcnwqwsdgtkpeykewheefeclisrtfdnqwlsapcsdtysfv
ckfea
Timeline for d1umrc_: