Lineage for d1umpc2 (1ump C:37-307)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 646026Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 646052Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 646059Protein Squalene-hopene cyclase [48244] (1 species)
  7. 646060Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)
  8. 646070Domain d1umpc2: 1ump C:37-307 [99624]
    complexed with c8e, sqa

Details for d1umpc2

PDB Entry: 1ump (more details), 2.13 Å

PDB Description: geometry of triterpene conversion to pentacarbocyclic hopene
PDB Compounds: (C:) squalene--hopene cyclase

SCOP Domain Sequences for d1umpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umpc2 a.102.4.2 (C:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas

SCOP Domain Coordinates for d1umpc2:

Click to download the PDB-style file with coordinates for d1umpc2.
(The format of our PDB-style files is described here.)

Timeline for d1umpc2: