| Class a: All alpha proteins [46456] (258 folds) |
| Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) ![]() |
| Family a.102.4.2: Terpene synthases [48243] (2 proteins) consists of two toroid domains: one of six and one of five hairpins |
| Protein Squalene-hopene cyclase [48244] (1 species) |
| Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
| Domain d1umpa2: 1ump A:37-307 [99620] |
PDB Entry: 1ump (more details), 2.13 Å
SCOP Domain Sequences for d1umpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umpa2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas
Timeline for d1umpa2:
View in 3DDomains from other chains: (mouse over for more information) d1umpb1, d1umpb2, d1umpc1, d1umpc2 |