Lineage for d1umha_ (1umh A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777671Family b.18.1.21: F-box associated region, FBA [101585] (2 protein domains)
    automatically mapped to Pfam PF04300
  6. 1777672Protein F-box only protein 2 [101586] (1 species)
  7. 1777673Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries)
  8. 1777674Domain d1umha_: 1umh A: [99605]
    complexed with ni

Details for d1umha_

PDB Entry: 1umh (more details), 2 Å

PDB Description: Structural basis of sugar-recognizing ubiquitin ligase
PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d1umha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umha_ b.18.1.21 (A:) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
gshfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyf
assfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsened
vlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssv
wvep

SCOPe Domain Coordinates for d1umha_:

Click to download the PDB-style file with coordinates for d1umha_.
(The format of our PDB-style files is described here.)

Timeline for d1umha_: