SCOP 1.67: Domain d1umha_: 1umh A:

Lineage for d1umha_ (1umh A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (21 families)

5. Family b.18.1.21: F-box associated region, FBA [101585] (1 protein)

6. Protein F-box only protein 2 [101586] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries)

8. Domain d1umha_: 1umh A: [99605]
   complexed with ni

Details for d1umha_

PDB Entry: 1umh, 2 Å

PDB Description: Structural basis of sugar-recognizing ubiquitin ligase

SCOP Domain Sequences for d1umha_:

Sequence; same for both SEQRES and ATOM records:

>d1umha_ b.18.1.21 (A:) F-box only protein 2 {Mouse (Mus musculus)}
gshfyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyf
assfewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsened
vlaefatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssv
wvep

Timeline for d1umha_:

• d1umha_ is new in SCOP 1.67
  
• d1umha_ appears in SCOP 1.69
  
• d1umha_ appears in the current release, SCOPe 2.08, called d1umha1