Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.21: F-box associated region, FBA [101585] (2 proteins) automatically mapped to Pfam PF04300 |
Protein F-box only protein 2 [101586] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries) |
Domain d1umha1: 1umh A:117-297 [99605] Other proteins in same PDB: d1umha2 complexed with ni |
PDB Entry: 1umh (more details), 2 Å
SCOPe Domain Sequences for d1umha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umha1 b.18.1.21 (A:117-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]} fyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfass fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve p
Timeline for d1umha1: