SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1umha1 (1umh A:117-297)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2039145Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2039146Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2039835Family b.18.1.21: F-box associated region, FBA [101585] (2 protein domains)
    automatically mapped to Pfam PF04300
  6. 2039836Protein F-box only protein 2 [101586] (1 species)
  7. 2039837Species Mouse (Mus musculus) [TaxId:10090] [101587] (2 PDB entries)
  8. 2039838Domain d1umha1: 1umh A:117-297 [99605]
    Other proteins in same PDB: d1umha2
    complexed with ni

Details for d1umha1

PDB Entry: 1umh (more details), 2 Å

PDB Description: Structural basis of sugar-recognizing ubiquitin ligase
PDB Compounds: (A:) F-box only protein 2

SCOPe Domain Sequences for d1umha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umha1 b.18.1.21 (A:117-297) F-box only protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
fyflskrrrnllrnpcgeedlegwsdvehggdgwkveelpgdngveftqddsvkkyfass
fewcrkaqvidlqaegyweelldttqpaivvkdwysgrtdagslyeltvrllsenedvla
efatgqvavpedgswmeishtfidygpgvrfvrfehggqdsvywkgwfgarvtnssvwve
p

SCOPe Domain Coordinates for d1umha1:

Click to download the PDB-style file with coordinates for d1umha1.
(The format of our PDB-style files is described here.)

Timeline for d1umha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1umha2