![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102337] (4 PDB entries) |
![]() | Domain d1umcc_: 1umc C: [99596] Other proteins in same PDB: d1umcb1, d1umcb2, d1umcd1, d1umcd2 complexed with 4mv, mg, tdp |
PDB Entry: 1umc (more details), 2.4 Å
SCOPe Domain Sequences for d1umcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umcc_ c.36.1.11 (C:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]} hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke e
Timeline for d1umcc_: