Lineage for d1umcc_ (1umc C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1593108Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1593112Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species)
  7. 1593133Species Thermus thermophilus [TaxId:274] [102337] (4 PDB entries)
  8. 1593141Domain d1umcc_: 1umc C: [99596]
    Other proteins in same PDB: d1umcb1, d1umcb2, d1umcd1, d1umcd2
    complexed with 4mv, mg, tdp

Details for d1umcc_

PDB Entry: 1umc (more details), 2.4 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate
PDB Compounds: (C:) 2-oxo acid dehydrogenase alpha subunit

SCOPe Domain Sequences for d1umcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umcc_ c.36.1.11 (C:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus [TaxId: 274]}
hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
e

SCOPe Domain Coordinates for d1umcc_:

Click to download the PDB-style file with coordinates for d1umcc_.
(The format of our PDB-style files is described here.)

Timeline for d1umcc_: