SCOP 1.69: Domain d1umcc_: 1umc C:

Lineage for d1umcc_ (1umc C:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (3 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102337] (4 PDB entries)

8. Domain d1umcc_: 1umc C: [99596]
   Other proteins in same PDB: d1umcb1, d1umcb2, d1umcd1, d1umcd2

Details for d1umcc_

PDB Entry: 1umc, 2.4 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate

SCOP Domain Sequences for d1umcc_:

Sequence; same for both SEQRES and ATOM records:

>d1umcc_ c.36.1.11 (C:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus}
hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
e

Timeline for d1umcc_:

• d1umcc_ first appeared in SCOP 1.67
  
• d1umcc_ appears in SCOP 1.71
  
• d1umcc_ appears in the current release, SCOPe 2.08