Lineage for d1umcb2 (1umc B:188-324)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 585468Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 585469Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 585503Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 585507Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 585523Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)
  8. 585530Domain d1umcb2: 1umc B:188-324 [99595]
    Other proteins in same PDB: d1umca_, d1umcb1, d1umcc_, d1umcd1

Details for d1umcb2

PDB Entry: 1umc (more details), 2.4 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate

SCOP Domain Sequences for d1umcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umcb2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

SCOP Domain Coordinates for d1umcb2:

Click to download the PDB-style file with coordinates for d1umcb2.
(The format of our PDB-style files is described here.)

Timeline for d1umcb2: