SCOPe 2.06: Domain d1umbd2: 1umb D:188-324

Lineage for d1umbd2 (1umb D:188-324)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
   automatically mapped to Pfam PF02780

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)

8. Domain d1umbd2: 1umb D:188-324 [99592]
   Other proteins in same PDB: d1umba_, d1umbb1, d1umbc_, d1umbd1
   complexed with mg, tdp

Details for d1umbd2

PDB Entry: 1umb, 2.1 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form

PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1umbd2:

Sequence; same for both SEQRES and ATOM records:

>d1umbd2 c.48.1.2 (D:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

Timeline for d1umbd2:

• d1umbd2 first appeared in SCOP 1.67
  
• d1umbd2 appears in SCOPe 2.05
  
• d1umbd2 appears in SCOPe 2.07
  
• d1umbd2 appears in the current release, SCOPe 2.08