Lineage for d1umbd1 (1umb D:2-187)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393157Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 393161Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)
  7. 393167Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries)
  8. 393171Domain d1umbd1: 1umb D:2-187 [99591]
    Other proteins in same PDB: d1umba_, d1umbb2, d1umbc_, d1umbd2
    complexed with mg, tdp

Details for d1umbd1

PDB Entry: 1umb (more details), 2.1 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form

SCOP Domain Sequences for d1umbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umbd1 c.36.1.7 (D:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus}
almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
eevpee

SCOP Domain Coordinates for d1umbd1:

Click to download the PDB-style file with coordinates for d1umbd1.
(The format of our PDB-style files is described here.)

Timeline for d1umbd1: