Lineage for d1umba_ (1umb A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483377Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 483378Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 483633Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (3 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 483637Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species)
  7. 483647Species Thermus thermophilus [TaxId:274] [102337] (4 PDB entries)
  8. 483650Domain d1umba_: 1umb A: [99587]
    Other proteins in same PDB: d1umbb1, d1umbb2, d1umbd1, d1umbd2

Details for d1umba_

PDB Entry: 1umb (more details), 2.1 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form

SCOP Domain Sequences for d1umba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umba_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus}
hrfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgkts
fiapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkg
rqmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwya
ginfaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyy
vvkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrfle
arglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallke
el

SCOP Domain Coordinates for d1umba_:

Click to download the PDB-style file with coordinates for d1umba_.
(The format of our PDB-style files is described here.)

Timeline for d1umba_: