![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) ![]() |
![]() | Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins) automatically mapped to Pfam PF02780 |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries) |
![]() | Domain d1um9d2: 1um9 D:188-324 [99586] Other proteins in same PDB: d1um9a_, d1um9b1, d1um9c_, d1um9d1 complexed with so4 |
PDB Entry: 1um9 (more details), 2.2 Å
SCOPe Domain Sequences for d1um9d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1um9d2 c.48.1.2 (D:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]} dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly lptvtrilnaakraldy
Timeline for d1um9d2:
![]() Domains from other chains: (mouse over for more information) d1um9a_, d1um9b1, d1um9b2, d1um9c_ |