Lineage for d1um9d2 (1um9 D:188-324)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1169947Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1169948Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 1170000Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
  6. 1170008Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 1170031Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)
  8. 1170037Domain d1um9d2: 1um9 D:188-324 [99586]
    Other proteins in same PDB: d1um9a_, d1um9b1, d1um9c_, d1um9d1
    complexed with so4

Details for d1um9d2

PDB Entry: 1um9 (more details), 2.2 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 in apo-form
PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1um9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um9d2 c.48.1.2 (D:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

SCOPe Domain Coordinates for d1um9d2:

Click to download the PDB-style file with coordinates for d1um9d2.
(The format of our PDB-style files is described here.)

Timeline for d1um9d2: