SCOPe 2.03: Domain d1um9d1: 1um9 D:2-187

Lineage for d1um9d1 (1um9 D:2-187)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries)

8. Domain d1um9d1: 1um9 D:2-187 [99585]
   Other proteins in same PDB: d1um9a_, d1um9b2, d1um9c_, d1um9d2
   complexed with so4

Details for d1um9d1

PDB Entry: 1um9, 2.2 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 in apo-form

PDB Compounds: (D:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1um9d1:

Sequence; same for both SEQRES and ATOM records:

>d1um9d1 c.36.1.7 (D:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus [TaxId: 274]}
almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea
aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg
gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk
eevpee

Timeline for d1um9d1:

• d1um9d1 first appeared in SCOP 1.67
  
• d1um9d1 appears in SCOPe 2.02
  
• d1um9d1 appears in SCOPe 2.04
  
• d1um9d1 appears in the current release, SCOPe 2.08