![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
![]() | Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102332] (4 PDB entries) |
![]() | Domain d1um9d1: 1um9 D:2-187 [99585] Other proteins in same PDB: d1um9a_, d1um9b2, d1um9c_, d1um9d2 complexed with so4 |
PDB Entry: 1um9 (more details), 2.2 Å
SCOP Domain Sequences for d1um9d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1um9d1 c.36.1.7 (D:2-187) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Thermus thermophilus} almtmvqalnraldeemakdprvvvlgedvgkrggvflvtegllqkygpdrvmdtplsea aivgaalgmaahglrpvaeiqfadyifpgfdqlvsqvaklryrsggqftaplvvrmpsgg gvrgghhhsqspeahfvhtaglkvvavstpydakgllkaairdedpvvflepkrlyrsvk eevpee
Timeline for d1um9d1:
![]() Domains from other chains: (mouse over for more information) d1um9a_, d1um9b1, d1um9b2, d1um9c_ |