Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (3 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species) |
Species Thermus thermophilus [TaxId:274] [102337] (4 PDB entries) |
Domain d1um9c_: 1um9 C: [99584] Other proteins in same PDB: d1um9b1, d1um9b2, d1um9d1, d1um9d2 complexed with so4 |
PDB Entry: 1um9 (more details), 2.2 Å
SCOP Domain Sequences for d1um9c_:
Sequence, based on SEQRES records: (download)
>d1um9c_ c.36.1.11 (C:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus} rfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgktsf iapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkgr qmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwyag infaavqgapavfiaennfyaisvdyrhqthsptiadkahafgipgylvdgmdvlasyyv vkeaverarrgegpslvelrvyrygphssadddsryrpkeevafwrkkdpiprfrrflea rglwneeweedvreeiraelerglkeaeeagpvppewmfedvfaekpwhllrqeallkee l
>d1um9c_ c.36.1.11 (C:) Branched-chain alpha-keto acid dehydrogenase, PP module {Thermus thermophilus} rfetfteepirligeegewlgdfpldlegeklrrlyrdmlaarmlderytilirtgktsf iapaagheaaqvaiahairpgfdwvfpyyrdhglalalgiplkellgqmlatkadpnkgr qmpehpgskalnfftvaspiashvppaagaaismkllrtgqvavctfgdgatsegdwyag infaavqgapavfiaennfptiadkahafgipgylvdgmdvlasyyvvkeaverarrgeg pslvelrvyrygphssaddrkkdpiprfrrflearglwneeweedvreeiraelerglke aeeagpvppewmfedvfaekpwhllrqeallkeel
Timeline for d1um9c_: