Lineage for d1um9b2 (1um9 B:188-324)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488514Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2488515Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2488567Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 2488571Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 2488596Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)
  8. 2488601Domain d1um9b2: 1um9 B:188-324 [99583]
    Other proteins in same PDB: d1um9a_, d1um9b1, d1um9c_, d1um9d1
    complexed with so4

Details for d1um9b2

PDB Entry: 1um9 (more details), 2.2 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 in apo-form
PDB Compounds: (B:) 2-oxo acid dehydrogenase beta subunit

SCOPe Domain Sequences for d1um9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um9b2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus [TaxId: 274]}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

SCOPe Domain Coordinates for d1um9b2:

Click to download the PDB-style file with coordinates for d1um9b2.
(The format of our PDB-style files is described here.)

Timeline for d1um9b2: