SCOP 1.69: Domain d1um9b2: 1um9 B:188-324

Lineage for d1um9b2 (1um9 B:188-324)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest

4. Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families)

5. Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (3 proteins)

6. Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102468] (4 PDB entries)

8. Domain d1um9b2: 1um9 B:188-324 [99583]
   Other proteins in same PDB: d1um9a_, d1um9b1, d1um9c_, d1um9d1

Details for d1um9b2

PDB Entry: 1um9, 2.2 Å

PDB Description: branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 in apo-form

SCOP Domain Sequences for d1um9b2:

Sequence; same for both SEQRES and ATOM records:

>d1um9b2 c.48.1.2 (B:188-324) Branched-chain alpha-keto acid dehydrogenase {Thermus thermophilus}
dytlpigkaalrregkdltlicygtvmpevlqaaaelakagvsaevldlrtlmpwdyeav
mnsvaktgrvvlvsdaprhasfvsevaatiaedlldmllappirvtgfdtpypyaqdkly
lptvtrilnaakraldy

Timeline for d1um9b2:

• d1um9b2 first appeared in SCOP 1.67
  
• d1um9b2 appears in SCOP 1.71
  
• d1um9b2 appears in the current release, SCOPe 2.08