Lineage for d1um7a1 (1um7 A:8-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786124Protein Synapse-associated protein 102 [101713] (1 species)
  7. 2786125Species Human (Homo sapiens) [TaxId:9606] [101714] (2 PDB entries)
  8. 2786127Domain d1um7a1: 1um7 A:8-107 [99579]
    Other proteins in same PDB: d1um7a2, d1um7a3
    third PDZ domain

Details for d1um7a1

PDB Entry: 1um7 (more details)

PDB Description: solution structure of the third pdz domain of synapse-associated protein 102
PDB Compounds: (A:) synapse-associated protein 102

SCOPe Domain Sequences for d1um7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um7a1 b.36.1.1 (A:8-107) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]}
rpggdareprkiilhkgstglgfnivggedgegifvsfilaggpadlsgelrrgdrilsv
ngvnlrnatheqaaaalkragqsvtivaqyrpeeysrfes

SCOPe Domain Coordinates for d1um7a1:

Click to download the PDB-style file with coordinates for d1um7a1.
(The format of our PDB-style files is described here.)

Timeline for d1um7a1: