Lineage for d1um1a1 (1um1 A:8-104)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395570Protein Hypothetical protein KIAA1849 [101729] (1 species)
  7. 2395571Species Human (Homo sapiens) [TaxId:9606] [101730] (1 PDB entry)
  8. 2395572Domain d1um1a1: 1um1 A:8-104 [99578]
    Other proteins in same PDB: d1um1a2, d1um1a3
    structural genomics; Rsgi Ruh-007 domain

Details for d1um1a1

PDB Entry: 1um1 (more details)

PDB Description: solution structure of rsgi ruh-007, pdz domain in human cdna
PDB Compounds: (A:) KIAA1849 protein

SCOPe Domain Sequences for d1um1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1um1a1 b.36.1.1 (A:8-104) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]}
yvftvelergpsglgmglidgmhthlgapglyiqtllpgspaaadgrlslgdrilevngs
sllglgylravdlirhggkkmrflvaksdvetakkih

SCOPe Domain Coordinates for d1um1a1:

Click to download the PDB-style file with coordinates for d1um1a1.
(The format of our PDB-style files is described here.)

Timeline for d1um1a1: