SCOP 1.67: Domain d1um1a_: 1um1 A:

Lineage for d1um1a_ (1um1 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (24 proteins)

6. Protein Hypothetical protein KIAA1849 [101729] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101730] (1 PDB entry)

8. Domain d1um1a_: 1um1 A: [99578]
   structural genomics; Rsgi Ruh-007 domain

Details for d1um1a_

PDB Entry: 1um1

PDB Description: solution structure of rsgi ruh-007, pdz domain in human cdna

SCOP Domain Sequences for d1um1a_:

Sequence; same for both SEQRES and ATOM records:

>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens)}
gssgssgyvftvelergpsglgmglidgmhthlgapglyiqtllpgspaaadgrlslgdr
ilevngssllglgylravdlirhggkkmrflvaksdvetakkihsgpssg

Timeline for d1um1a_:

• d1um1a_ is new in SCOP 1.67
  
• d1um1a_ appears in SCOP 1.69
  
• d1um1a_ appears in the current release, SCOPe 2.08, called d1um1a1