Lineage for d1ulza3 (1ulz A:115-328)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585083Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2585090Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2585091Species Aquifex aeolicus [TaxId:63363] [103284] (1 PDB entry)
  8. 2585092Domain d1ulza3: 1ulz A:115-328 [99577]
    Other proteins in same PDB: d1ulza1, d1ulza2

Details for d1ulza3

PDB Entry: 1ulz (more details), 2.2 Å

PDB Description: Crystal structure of the biotin carboxylase subunit of pyruvate carboxylase
PDB Compounds: (A:) pyruvate carboxylase n-terminal domain

SCOPe Domain Sequences for d1ulza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]}
karskevmkkagvpvvpgsdgvlksleeakalareigypvllkataggggrgiricrnee
elvknyeqasreaekafgrgdlllekfienpkhieyqvlgdkhgnvihlgerdcsiqrrn
qklveiapsliltpekreyygnivtkaakeigyynagtmefiadqegnlyfiemntriqv
ehpvsemvtgidivkwqikiaagepltikqedvk

SCOPe Domain Coordinates for d1ulza3:

Click to download the PDB-style file with coordinates for d1ulza3.
(The format of our PDB-style files is described here.)

Timeline for d1ulza3: