Lineage for d1ulza3 (1ulz A:115-328)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418907Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 418908Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (7 families) (S)
  5. 418928Family d.142.1.2: BC ATP-binding domain-like [56067] (5 proteins)
  6. 418929Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 418930Species Aquifex aeolicus [TaxId:63363] [103284] (1 PDB entry)
  8. 418931Domain d1ulza3: 1ulz A:115-328 [99577]
    Other proteins in same PDB: d1ulza1, d1ulza2
    mutant

Details for d1ulza3

PDB Entry: 1ulz (more details), 2.2 Å

PDB Description: Crystal structure of the biotin carboxylase subunit of pyruvate carboxylase

SCOP Domain Sequences for d1ulza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus}
karskevmkkagvpvvpgsdgvlksleeakalareigypvllkataggggrgiricrnee
elvknyeqasreaekafgrgdlllekfienpkhieyqvlgdkhgnvihlgerdcsiqrrn
qklveiapsliltpekreyygnivtkaakeigyynagtmefiadqegnlyfiemntriqv
ehpvsemvtgidivkwqikiaagepltikqedvk

SCOP Domain Coordinates for d1ulza3:

Click to download the PDB-style file with coordinates for d1ulza3.
(The format of our PDB-style files is described here.)

Timeline for d1ulza3: