SCOP 1.69: Domain d1ulza2: 1ulz A:1-114

Lineage for d1ulza2 (1ulz A:1-114)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (6 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.1: BC N-terminal domain-like [52441] (5 proteins)

6. Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Aquifex aeolicus [TaxId:63363] [102283] (1 PDB entry)

8. Domain d1ulza2: 1ulz A:1-114 [99576]
   Other proteins in same PDB: d1ulza1, d1ulza3

Details for d1ulza2

PDB Entry: 1ulz, 2.2 Å

PDB Description: crystal structure of the biotin carboxylase subunit of pyruvate carboxylase

SCOP Domain Sequences for d1ulza2:

Sequence; same for both SEQRES and ATOM records:

>d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus}
mvnkvlvanrgeiavriirackelgiptvaiynevestarhvkladeaymigtdpldtyl
nkqriinlalevgadaihpgygflaenaefakmceeagitfigphwkvielmgd

Timeline for d1ulza2:

• d1ulza2 first appeared in SCOP 1.67
  
• d1ulza2 appears in SCOP 1.71
  
• d1ulza2 appears in the current release, SCOPe 2.08