Lineage for d1ulva4 (1ulv A:2-273)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372299Family b.30.5.5: Bacterial glucoamylase N-terminal domain-like [82042] (2 proteins)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
  6. 372306Protein Glucodextranase, domain N [101661] (1 species)
  7. 372307Species Arthrobacter globiformis [TaxId:1665] [101662] (2 PDB entries)
  8. 372309Domain d1ulva4: 1ulv A:2-273 [99574]
    Other proteins in same PDB: d1ulva1, d1ulva2, d1ulva3
    complexed with acr, ca

Details for d1ulva4

PDB Entry: 1ulv (more details), 2.42 Å

PDB Description: crystal structure of glucodextranase complexed with acarbose

SCOP Domain Sequences for d1ulva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulva4 b.30.5.5 (A:2-273) Glucodextranase, domain N {Arthrobacter globiformis}
taeppgspgaaatwtkgdkegvgtslnpaskvwytltegtmsevyyphadtpntrelqfa
vsdgtsaqreseqttrtveladpkalsyrqtttdnagrwrltktyvtdprrstvmlgvtf
evldggdyqlfvlsdpslagtsggdtgsvtdgallasdladaatpvatalvssvgfgava
ngyvgtsdgwtdlaadgrldnasatagpgnisqtgqiplaaggktefslalgfgadtaea
latakaslgtgykkvsksytgewkkylnslda

SCOP Domain Coordinates for d1ulva4:

Click to download the PDB-style file with coordinates for d1ulva4.
(The format of our PDB-style files is described here.)

Timeline for d1ulva4: