Lineage for d1ulva3 (1ulv A:776-1020)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367515Superfamily b.1.9: CBD9-like [49344] (3 families) (S)
    has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site
  5. 367533Family b.1.9.3: Glucodextranase, domain C [101533] (1 protein)
  6. 367534Protein Glucodextranase, domain C [101534] (1 species)
  7. 367535Species Arthrobacter globiformis [TaxId:1665] [101535] (2 PDB entries)
  8. 367537Domain d1ulva3: 1ulv A:776-1020 [99573]
    Other proteins in same PDB: d1ulva1, d1ulva2, d1ulva4
    complexed with acr, ca

Details for d1ulva3

PDB Entry: 1ulv (more details), 2.42 Å

PDB Description: crystal structure of glucodextranase complexed with acarbose

SCOP Domain Sequences for d1ulva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulva3 b.1.9.3 (A:776-1020) Glucodextranase, domain C {Arthrobacter globiformis}
rigalsdpagddngpgtyryptnsayvpgafdltgvdvydagddyafvatiagevtnpwg
gqaishqrvniylgkgeggatpglpgtninlehawdsvivtdgrfdgagvyapdgtrtsa
vsllavpearqivtrvpkaalggldpatarmsvamfgnaesgegignvrpvydgayweag
dpawikewrfgggagvfdgtipsrdtdtddpnaldvlvgegqtqaavldwragspvvvpm
lglqp

SCOP Domain Coordinates for d1ulva3:

Click to download the PDB-style file with coordinates for d1ulva3.
(The format of our PDB-style files is described here.)

Timeline for d1ulva3: