SCOPe 2.05: Domain d1ulva2: 1ulv A:687-775

Lineage for d1ulva2 (1ulv A:687-775)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glucodextranase, domain B [101525] (1 species)

7. Species Arthrobacter globiformis [TaxId:1665] [101526] (2 PDB entries)

8. Domain d1ulva2: 1ulv A:687-775 [99572]
   Other proteins in same PDB: d1ulva1, d1ulva3, d1ulva4
   complexed with acr, ca

Details for d1ulva2

PDB Entry: 1ulv, 2.42 Å

PDB Description: crystal structure of glucodextranase complexed with acarbose

PDB Compounds: (A:) glucodextranase

SCOPe Domain Sequences for d1ulva2:

Sequence; same for both SEQRES and ATOM records:

>d1ulva2 b.1.18.2 (A:687-775) Glucodextranase, domain B {Arthrobacter globiformis [TaxId: 1665]}
tplsspelsvtapealstadsatavvrgttnaakvyvsvngtateapvtdgtfsldvalt
gaknkvtvaavaadggtavedrtvlyygs

Timeline for d1ulva2:

• d1ulva2 first appeared in SCOP 1.67
  
• d1ulva2 appears in SCOPe 2.04
  
• d1ulva2 appears in SCOPe 2.06
  
• d1ulva2 appears in the current release, SCOPe 2.08