Lineage for d1ulva2 (1ulv A:687-775)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111574Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1111680Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 1111819Protein Glucodextranase, domain B [101525] (1 species)
  7. 1111820Species Arthrobacter globiformis [TaxId:1665] [101526] (2 PDB entries)
  8. 1111821Domain d1ulva2: 1ulv A:687-775 [99572]
    Other proteins in same PDB: d1ulva1, d1ulva3, d1ulva4
    complexed with acr, ca

Details for d1ulva2

PDB Entry: 1ulv (more details), 2.42 Å

PDB Description: crystal structure of glucodextranase complexed with acarbose
PDB Compounds: (A:) glucodextranase

SCOPe Domain Sequences for d1ulva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulva2 b.1.18.2 (A:687-775) Glucodextranase, domain B {Arthrobacter globiformis [TaxId: 1665]}
tplsspelsvtapealstadsatavvrgttnaakvyvsvngtateapvtdgtfsldvalt
gaknkvtvaavaadggtavedrtvlyygs

SCOPe Domain Coordinates for d1ulva2:

Click to download the PDB-style file with coordinates for d1ulva2.
(The format of our PDB-style files is described here.)

Timeline for d1ulva2: