Lineage for d1ulva1 (1ulv A:274-686)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 446542Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 446543Superfamily a.102.1: Six-hairpin glycosidases [48208] (7 families) (S)
  5. 446639Family a.102.1.5: Bacterial glucoamylase C-terminal domain-like [81850] (2 proteins)
    overall domain organization is similar to Lactobacillus maltose phosphorylase
  6. 446646Protein Glucodextranase, domain A [101365] (1 species)
  7. 446647Species Arthrobacter globiformis [TaxId:1665] [101366] (2 PDB entries)
  8. 446649Domain d1ulva1: 1ulv A:274-686 [99571]
    Other proteins in same PDB: d1ulva2, d1ulva3, d1ulva4

Details for d1ulva1

PDB Entry: 1ulv (more details), 2.42 Å

PDB Description: crystal structure of glucodextranase complexed with acarbose

SCOP Domain Sequences for d1ulva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis}
patsltgalrtqydvslmtvkshedktfpgafiasltipwgqaasaethregyhavward
myqsvtallaagdeeaaargvewlftyqqqpdghfpqtsrvdgtigqngiqldetafpil
lanqigrtdagfyrnelkpaadylvaagpktpqerweetggyststlasqiaalaaaadi
agkngdagsaavyratadewqrstekwmfttngpvgdgkyylrisatgnpndgatrdwgn
gagvhpenavldggflefvrlgvkapadpyvadslaetdasisqetpggrmwhrytydgy
gekadgspwdgtgigrlwpllsgergeyalangqdalpyletmhsaanagymipeqvwdr
deptsyghelgrstgsasplswamaqyvrlaagvkagapvetpqnvaaryaag

SCOP Domain Coordinates for d1ulva1:

Click to download the PDB-style file with coordinates for d1ulva1.
(The format of our PDB-style files is described here.)

Timeline for d1ulva1: