Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) |
Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins) |
Protein Lectin-D [103524] (1 species) consists of two homologous domains |
Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries) |
Domain d1ulna2: 1uln A:43-82 [99570] isoform D1 |
PDB Entry: 1uln (more details), 1.65 Å
SCOPe Domain Sequences for d1ulna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulna2 g.3.1.1 (A:43-82) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]} wrcgrdfggrlceedmccskygwcgysddhcedgcqsqcd
Timeline for d1ulna2: