Lineage for d1ulmb1 (1ulm B:101-142)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257051Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2257052Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2257089Protein Lectin-D [103524] (1 species)
    consists of two homologous domains
  7. 2257090Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)
  8. 2257097Domain d1ulmb1: 1ulm B:101-142 [99567]
    isoform D2

Details for d1ulmb1

PDB Entry: 1ulm (more details), 1.8 Å

PDB Description: crystal structure of pokeweed lectin-d2 complexed with tri-n- acetylchitotriose
PDB Compounds: (B:) lectin-D2

SCOPe Domain Sequences for d1ulmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulmb1 g.3.1.1 (B:101-142) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

SCOPe Domain Coordinates for d1ulmb1:

Click to download the PDB-style file with coordinates for d1ulmb1.
(The format of our PDB-style files is described here.)

Timeline for d1ulmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulmb2