SCOP 1.75: Domain d1ulmb1: 1ulm B:101-142

Lineage for d1ulmb1 (1ulm B:101-142)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families)

5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)

6. Protein Lectin-D [103524] (1 species)
   consists of two homologous domains

7. Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)

8. Domain d1ulmb1: 1ulm B:101-142 [99567]
   isoform D2

Details for d1ulmb1

PDB Entry: 1ulm, 1.8 Å

PDB Description: crystal structure of pokeweed lectin-d2 complexed with tri-n- acetylchitotriose

PDB Compounds: (B:) lectin-D2

SCOP Domain Sequences for d1ulmb1:

Sequence; same for both SEQRES and ATOM records:

>d1ulmb1 g.3.1.1 (B:101-142) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

Timeline for d1ulmb1:

• d1ulmb1 first appeared in SCOP 1.67
  
• d1ulmb1 appears in SCOP 1.73
  
• d1ulmb1 appears in SCOPe 2.01
  
• d1ulmb1 appears in the current release, SCOPe 2.08