Lineage for d1ulma2 (1ulm A:43-82)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2634701Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2634702Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. 2634739Protein Lectin-D [103524] (1 species)
    consists of two homologous domains
  7. 2634740Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)
  8. 2634746Domain d1ulma2: 1ulm A:43-82 [99566]
    isoform D2

Details for d1ulma2

PDB Entry: 1ulm (more details), 1.8 Å

PDB Description: crystal structure of pokeweed lectin-d2 complexed with tri-n- acetylchitotriose
PDB Compounds: (A:) lectin-D2

SCOPe Domain Sequences for d1ulma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulma2 g.3.1.1 (A:43-82) Lectin-D {American pokeweed (Phytolacca americana) [TaxId: 3527]}
wrcgrdfggrlceedmccskygwcgysddhcedgcqsqcd

SCOPe Domain Coordinates for d1ulma2:

Click to download the PDB-style file with coordinates for d1ulma2.
(The format of our PDB-style files is described here.)

Timeline for d1ulma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulma1