Lineage for d1ulma1 (1ulm A:1-42)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 427258Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 427259Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 427260Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (5 proteins)
  6. 427291Protein Lectin-D [103524] (1 species)
    consists of two homologous domains
  7. 427292Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)
  8. 427297Domain d1ulma1: 1ulm A:1-42 [99565]

Details for d1ulma1

PDB Entry: 1ulm (more details), 1.8 Å

PDB Description: crystal structure of pokeweed lectin-d2 complexed with tri-n- acetylchitotriose

SCOP Domain Sequences for d1ulma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulma1 g.3.1.1 (A:1-42) Lectin-D {American pokeweed (Phytolacca americana)}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

SCOP Domain Coordinates for d1ulma1:

Click to download the PDB-style file with coordinates for d1ulma1.
(The format of our PDB-style files is described here.)

Timeline for d1ulma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ulma2