SCOP 1.67: Domain d1ulma1: 1ulm A:1-42

Lineage for d1ulma1 (1ulm A:1-42)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families)

5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (5 proteins)

6. Protein Lectin-D [103524] (1 species)
   consists of two homologous domains

7. Species American pokeweed (Phytolacca americana) [TaxId:3527] [103525] (3 PDB entries)

8. Domain d1ulma1: 1ulm A:1-42 [99565]

Details for d1ulma1

PDB Entry: 1ulm, 1.8 Å

PDB Description: crystal structure of pokeweed lectin-d2 complexed with tri-n- acetylchitotriose

SCOP Domain Sequences for d1ulma1:

Sequence; same for both SEQRES and ATOM records:

>d1ulma1 g.3.1.1 (A:1-42) Lectin-D {American pokeweed (Phytolacca americana)}
apecgerasgkrcpngkccsqwgycgttdnycgqgcqsqcdy

Timeline for d1ulma1:

• d1ulma1 is new in SCOP 1.67
  
• d1ulma1 appears in SCOP 1.69
  
• d1ulma1 appears in the current release, SCOPe 2.08