Lineage for d1ulkb3 (1ulk B:284-326)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (7 proteins)
  6. Protein Lectin-C [103522] (1 species)
    consists of three homologous domains
  7. Species American pokeweed (Phytolacca americana) [TaxId:3527] [103523] (1 PDB entry)
  8. Domain d1ulkb3: 1ulk B:284-326 [99564]

Details for d1ulkb3

PDB Entry: 1ulk (more details), 1.8 Å

PDB Description: Crystal Structure of Pokeweed Lectin-C
PDB Compounds: (B:) lectin-C

SCOPe Domain Sequences for d1ulkb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulkb3 g.3.1.1 (B:284-326) Lectin-C {American pokeweed (Phytolacca americana) [TaxId: 3527]}
wrcgkdfggrlctedmccsqygwcgltddhcedgcqsqcdlpt

SCOPe Domain Coordinates for d1ulkb3 are not available.

Timeline for d1ulkb3:

Domains from same chain:
(mouse over for more information)
d1ulkb1, d1ulkb2
Domains from other chains:
(mouse over for more information)
d1ulka1, d1ulka2, d1ulka3