Lineage for d1ulkb1 (1ulk B:201-242)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 521093Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 521094Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families) (S)
  5. 521095Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)
  6. 521123Protein Lectin-C [103522] (1 species)
    consists of three homologous domains
  7. 521124Species American pokeweed (Phytolacca americana) [TaxId:3527] [103523] (1 PDB entry)
  8. 521128Domain d1ulkb1: 1ulk B:201-242 [99562]

Details for d1ulkb1

PDB Entry: 1ulk (more details), 1.8 Å

PDB Description: Crystal Structure of Pokeweed Lectin-C

SCOP Domain Sequences for d1ulkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulkb1 g.3.1.1 (B:201-242) Lectin-C {American pokeweed (Phytolacca americana)}
apvcgvrasgrvcpdgyccsqwgycgtteeycgkgcqsqcdy

SCOP Domain Coordinates for d1ulkb1:

Click to download the PDB-style file with coordinates for d1ulkb1.
(The format of our PDB-style files is described here.)

Timeline for d1ulkb1: