SCOP 1.69: Domain d1ulkb1: 1ulk B:201-242

Lineage for d1ulkb1 (1ulk B:201-242)

1. Root: SCOP 1.69

2. Class g: Small proteins [56992] (75 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families)

5. Family g.3.1.1: Hevein-like agglutinin (lectin) domain [57017] (6 proteins)

6. Protein Lectin-C [103522] (1 species)
   consists of three homologous domains

7. Species American pokeweed (Phytolacca americana) [TaxId:3527] [103523] (1 PDB entry)

8. Domain d1ulkb1: 1ulk B:201-242 [99562]

Details for d1ulkb1

PDB Entry: 1ulk, 1.8 Å

PDB Description: Crystal Structure of Pokeweed Lectin-C

SCOP Domain Sequences for d1ulkb1:

Sequence; same for both SEQRES and ATOM records:

>d1ulkb1 g.3.1.1 (B:201-242) Lectin-C {American pokeweed (Phytolacca americana)}
apvcgvrasgrvcpdgyccsqwgycgtteeycgkgcqsqcdy

Timeline for d1ulkb1:

• d1ulkb1 first appeared in SCOP 1.67
  
• d1ulkb1 appears in SCOP 1.71
  
• d1ulkb1 appears in the current release, SCOPe 2.08