Class b: All beta proteins [48724] (141 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
Protein Galectin-2 [101639] (1 species) |
Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries) |
Domain d1ulgd_: 1ulg D: [99556] complexed with gal, nga |
PDB Entry: 1ulg (more details), 2.2 Å
SCOP Domain Sequences for d1ulgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulgd_ b.29.1.3 (D:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea)} mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena aaiaynaenslfsspvtvdvhgllpplppa
Timeline for d1ulgd_: