SCOPe 2.07: Domain d1ulgc_: 1ulg C:

Lineage for d1ulgc_ (1ulg C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-2 [101639] (1 species)

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)

8. Domain d1ulgc_: 1ulg C: [99555]

Details for d1ulgc_

PDB Entry: 1ulg, 2.2 Å

PDB Description: cgl2 in complex with thomsen-friedenreich antigen

PDB Compounds: (C:) galectin-2

SCOPe Domain Sequences for d1ulgc_:

Sequence; same for both SEQRES and ATOM records:

>d1ulgc_ b.29.1.3 (C:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

Timeline for d1ulgc_:

• d1ulgc_ first appeared in SCOP 1.67
  
• d1ulgc_ appears in SCOPe 2.06
  
• d1ulgc_ appears in the current release, SCOPe 2.08