Lineage for d1ulgc_ (1ulg C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050578Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2050695Protein Galectin-2 [101639] (1 species)
  7. 2050696Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)
  8. 2050707Domain d1ulgc_: 1ulg C: [99555]

Details for d1ulgc_

PDB Entry: 1ulg (more details), 2.2 Å

PDB Description: cgl2 in complex with thomsen-friedenreich antigen
PDB Compounds: (C:) galectin-2

SCOPe Domain Sequences for d1ulgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulgc_ b.29.1.3 (C:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOPe Domain Coordinates for d1ulgc_:

Click to download the PDB-style file with coordinates for d1ulgc_.
(The format of our PDB-style files is described here.)

Timeline for d1ulgc_: