SCOPe 2.05: Domain d1ulgb_: 1ulg B:

Lineage for d1ulgb_ (1ulg B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-2 [101639] (1 species)

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)

8. Domain d1ulgb_: 1ulg B: [99554]

Details for d1ulgb_

PDB Entry: 1ulg, 2.2 Å

PDB Description: cgl2 in complex with thomsen-friedenreich antigen

PDB Compounds: (B:) galectin-2

SCOPe Domain Sequences for d1ulgb_:

Sequence; same for both SEQRES and ATOM records:

>d1ulgb_ b.29.1.3 (B:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

Timeline for d1ulgb_:

• d1ulgb_ first appeared in SCOP 1.67
  
• d1ulgb_ appears in SCOPe 2.04
  
• d1ulgb_ appears in SCOPe 2.06
  
• d1ulgb_ appears in the current release, SCOPe 2.08