Lineage for d1ulga_ (1ulg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2388863Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2388991Protein Galectin-2 [101639] (1 species)
  7. 2388992Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)
  8. 2389001Domain d1ulga_: 1ulg A: [99553]

Details for d1ulga_

PDB Entry: 1ulg (more details), 2.2 Å

PDB Description: cgl2 in complex with thomsen-friedenreich antigen
PDB Compounds: (A:) galectin-2

SCOPe Domain Sequences for d1ulga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulga_ b.29.1.3 (A:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOPe Domain Coordinates for d1ulga_:

Click to download the PDB-style file with coordinates for d1ulga_.
(The format of our PDB-style files is described here.)

Timeline for d1ulga_: