Lineage for d1ulfb_ (1ulf B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780718Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 1780819Protein Galectin-2 [101639] (1 species)
  7. 1780820Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)
  8. 1780834Domain d1ulfb_: 1ulf B: [99552]

Details for d1ulfb_

PDB Entry: 1ulf (more details), 2.36 Å

PDB Description: cgl2 in complex with blood group a tetrasaccharide
PDB Compounds: (B:) galectin-2

SCOPe Domain Sequences for d1ulfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulfb_ b.29.1.3 (B:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOPe Domain Coordinates for d1ulfb_:

Click to download the PDB-style file with coordinates for d1ulfb_.
(The format of our PDB-style files is described here.)

Timeline for d1ulfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ulfa_