| Class b: All beta proteins [48724] (141 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
| Protein Galectin-2 [101639] (1 species) |
| Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries) |
| Domain d1ulfb_: 1ulf B: [99552] complexed with fuc, gal, glc, nga |
PDB Entry: 1ulf (more details), 2.36 Å
SCOP Domain Sequences for d1ulfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulfb_ b.29.1.3 (B:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea)}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa
Timeline for d1ulfb_: