Lineage for d1uleb_ (1ule B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371566Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 371608Protein Galectin-2 [101639] (1 species)
  7. 371609Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)
  8. 371611Domain d1uleb_: 1ule B: [99550]
    complexed with gal, nag

Details for d1uleb_

PDB Entry: 1ule (more details), 2.15 Å

PDB Description: cgl2 in complex with linear b2 trisaccharide

SCOP Domain Sequences for d1uleb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uleb_ b.29.1.3 (B:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea)}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOP Domain Coordinates for d1uleb_:

Click to download the PDB-style file with coordinates for d1uleb_.
(The format of our PDB-style files is described here.)

Timeline for d1uleb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ulea_