![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins) |
![]() | Protein Galectin-2 [101639] (1 species) |
![]() | Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries) |
![]() | Domain d1uleb_: 1ule B: [99550] complexed with gal, nag |
PDB Entry: 1ule (more details), 2.15 Å
SCOP Domain Sequences for d1uleb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uleb_ b.29.1.3 (B:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea)} mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena aaiaynaenslfsspvtvdvhgllpplppa
Timeline for d1uleb_: