Lineage for d1uldc_ (1uld C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. Protein Galectin-2 [101639] (1 species)
  7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)
  8. Domain d1uldc_: 1uld C: [99547]

Details for d1uldc_

PDB Entry: 1uld (more details), 2.1 Å

PDB Description: cgl2 in complex with blood group h type ii
PDB Compounds: (C:) galectin-2

SCOPe Domain Sequences for d1uldc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uldc_ b.29.1.3 (C:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOPe Domain Coordinates for d1uldc_ are not available.

Timeline for d1uldc_:

Domains from other chains:
(mouse over for more information)
d1ulda_, d1uldb_, d1uldd_