SCOPe 2.08: Domain d1ulcb_: 1ulc B:

Lineage for d1ulcb_ (1ulc B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-2 [101639] (1 species)

7. Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [101640] (6 PDB entries)

8. Domain d1ulcb_: 1ulc B: [99544]

Details for d1ulcb_

PDB Entry: 1ulc, 2.6 Å

PDB Description: cgl2 in complex with lactose

PDB Compounds: (B:) galectin-2

SCOPe Domain Sequences for d1ulcb_:

Sequence; same for both SEQRES and ATOM records:

>d1ulcb_ b.29.1.3 (B:) Galectin-2 {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

Timeline for d1ulcb_:

• d1ulcb_ first appeared in SCOP 1.67
  
• d1ulcb_ appears in SCOPe 2.07