Lineage for d1ul7a1 (1ul7 A:8-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2976205Superfamily d.129.6: KA1-like [103243] (3 families) (S)
    contains a single copy of this fold
  5. 2976206Family d.129.6.1: Kinase associated domain 1, KA1 [103244] (2 proteins)
    Pfam PF02149
  6. 2976207Protein Map/microtubule affinity-regulating kinase 3 [103245] (1 species)
  7. 2976208Species Mouse (Mus musculus) [TaxId:10090] [103246] (2 PDB entries)
    Uniprot Q8C6G9 373-452
  8. 2976209Domain d1ul7a1: 1ul7 A:8-102 [99540]
    Other proteins in same PDB: d1ul7a2

Details for d1ul7a1

PDB Entry: 1ul7 (more details)

PDB Description: solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
PDB Compounds: (A:) MAP/microtubule affinity-regulating kinase 3

SCOPe Domain Sequences for d1ul7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ul7a1 d.129.6.1 (A:8-102) Map/microtubule affinity-regulating kinase 3 {Mouse (Mus musculus) [TaxId: 10090]}
rftwsmkttssmdpsdmmreirkvlganncdyeqrerfllfcvhgdghaenlvqwemevc
klprlslngvrfkrisgtsiafkniaskianelkl

SCOPe Domain Coordinates for d1ul7a1:

Click to download the PDB-style file with coordinates for d1ul7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ul7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ul7a2